PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.2NG276500.2.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family HD-ZIP
Protein Properties Length: 671aa    MW: 72886.7 Da    PI: 8.2822
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.2NG276500.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox30.27.8e-103421857
                         HHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHHC CS
             Homeobox 18 lFeknrypsaeereeLAkklgLterqVkvWFqNrRakekk 57
                         ++ ++ +p+ ++++ L + +gL  + Vk+WFqNrR   kk
  Pavir.2NG276500.2.p  3 AYDQCTHPDPQAMQALGAMIGLAPKYVKFWFQNRRSLVKK 42
                         7999*******************************87765 PP

2START1281.1e-401493684205
                          HHHHHHHHHHHHHC-TT-EEEE...EXCCTTEEEEEEESSS........SCEEEEEEEECCSCHHHHHHHHHCCCGGCT-TT-S...... CS
                START   4 eeaaqelvkkalaeepgWvkss...esengdevlqkfeeskv.......dsgealrasgvvdmvlallveellddkeqWdetla...... 77 
                           + +++++ +a+ +ep+W+  +   e  n+ e++ +++++         + +ea r+ ++v + +a+lv++++d++ +W+et++      
  Pavir.2NG276500.2.p 149 KASMEQFLVLATKGEPMWFPAAdggEVMNYVEYRAELSPAMIglrrpegFAVEATRDAAMVRGSAAELVSIFMDTA-RWSETFTgvvasv 237
                          678999****************999889999999999997779*********************************.*******887777 PP

                          .EEEEEEEECTTEEEEEEEEXXTTXX-SSX.EEEEEEEEEEE.TTS-EEEEEEEEE-TTS--..-TTSEE-EESSEEEEEEEECTCEEEE CS
                START  78 .kaetlevissggalqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppe.sssvvRaellpSgiliepksnghskv 164
                           + ++  +   +g +qlm+ae+ + sp vp R + ++Ry++   + +w+++dvSvd    ++   + ++ ++llpSg+lie++sngh+kv
  Pavir.2NG276500.2.p 238 vAGDVCVHCFADGQIQLMNAEMWVQSPCVPnRTVKILRYCKLVAERQWAVMDVSVDGIFGQQVlPARYMGCRLLPSGCLIEDMSNGHCKV 327
                          777777777777*******************************************9766665568************************* PP

                          EEEE-EE--SSXXHHHHHHHHHHHHHHHHHHHHHHTXXXXX CS
                START 165 twvehvdlkgrlphwllrslvksglaegaktwvatlqrqce 205
                          tw+ h+++++ + +  +r+l  +g+a ga +w+a lqrq+e
  Pavir.2NG276500.2.p 328 TWIVHAEYDETTMPPTFRPLFLNGQALGAHRWLASLQRQRE 368
                          ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007110.9143IPR001356Homeobox domain
CDDcd000863.11E-6243No hitNo description
PfamPF000461.8E-7242IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.601.0E-8342IPR009057Homeodomain-like
SuperFamilySSF466895.56E-8345IPR009057Homeodomain-like
PROSITE profilePS5084829.872137372IPR002913START domain
SMARTSM002342.5E-18146369IPR002913START domain
CDDcd088751.57E-74148368No hitNo description
PfamPF018529.1E-34149368IPR002913START domain
SuperFamilySSF559612.96E-19193364No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008289Molecular Functionlipid binding
Sequence ? help Back to Top
Protein Sequence    Length: 671 aa     Download sequence    Send to blast
MAAYDQCTHP DPQAMQALGA MIGLAPKYVK FWFQNRRSLV KKKDQLEQNQ QMQQVNASLK  60
AENRSLRKAV ETQRCVKCDG KIPPFNPLLE KQRLLAKNAQ LKDEILRVSA VHTKIIRDSA  120
LAQPVPWFSS SSSSSSSDAG REALLRHAKA SMEQFLVLAT KGEPMWFPAA DGGEVMNYVE  180
YRAELSPAMI GLRRPEGFAV EATRDAAMVR GSAAELVSIF MDTARWSETF TGVVASVVAG  240
DVCVHCFADG QIQLMNAEMW VQSPCVPNRT VKILRYCKLV AERQWAVMDV SVDGIFGQQV  300
LPARYMGCRL LPSGCLIEDM SNGHCKVTWI VHAEYDETTM PPTFRPLFLN GQALGAHRWL  360
ASLQRQREHA AALYSSLYPG NNNAAEAAGM LKLAQQMMAS FYAAVSGPIP RTPATTGIIN  420
DWFGSIGTGV ERFDAAVRMV TWEKPGGVKK PDPAEKQDFR FSRKILAEKF FLGGGAAGEP  480
ASWYLSATTT LRLPCTPPER VFGYLRDEQR RGEWDFVFAN GAAVQELRSV STGYLSGNVV  540
SILSNMTDGT KGRVLILQEA RTDASGSLVV YTPIGEEAMA MDAAMAAAAA SSFPTPSGFA  600
ILPDGRGSKA RHAPSTSSSA PVLRDGATGG SLVTMAYQVL LPGPPPDTAG AIDDIGKLIC  660
HVMETIKIIF *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008651755.10.0PREDICTED: uncharacterized protein LOC100383907 isoform X2
TrEMBLK4A0K40.0K4A0K4_SETIT; Uncharacterized protein
STRINGSi032393m0.0(Setaria italica)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G61150.11e-93homeodomain GLABROUS 1